PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 768aa    MW: 89220.8 Da    PI: 9.9001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014129genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
      Lus10014129 14 KGAWTKEEDDRLVSYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.65e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +Edel+++++ +lG++ W++Ia +++ gRt++++k++w+++
      Lus10014129  67 RGNFSDDEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.544961IPR017930Myb domain
SuperFamilySSF466897.49E-2813108IPR009057Homeodomain-like
SMARTSM007174.0E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001671.24E-91661No hitNo description
PROSITE profilePS5129427.98462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002493.7E-1567111IPR001005SANT/Myb domain
CDDcd001674.37E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLVSYIK SHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDDEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLNRG  120
IDPAPPRPLS DSSAAAAAGS CGGSPTACAT PAASSATISF TVRDQEDSKS SVRRNTTAMT  180
GTATSSTAAG EREKEDLKCP DLNLELRISP PYQDHFSGGR REGADXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  360
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  480
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  540
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  600
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  660
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  720
XHPPPFIHTF YSQIKRNLTQ IYLRNFPSLP ILPFFQMWNK PRKPKCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141167108B-MYB
1h8a_C5e-261311626128MYB TRANSFORMING PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-78myb domain protein 7